PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02742.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 250aa    MW: 28208.3 Da    PI: 6.7103
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02742.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.61.7e-141461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg+WTteEd++l++ +   G  +W++ ++  g++R++k+c++rw +yl
  Rsa1.0_02742.1_g00003.1 14 RGPWTTEEDKKLINFILTNGHYCWRALPNLAGLRRCGKSCRLRWTNYL 61
                             89******************99************************97 PP

2Myb_DNA-binding23.51.3e-07831032647
                              HHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding  26 tIartmgkgRtlkqcksrwqky 47 
                              +Ia++++ gRt++++k++w+++
  Rsa1.0_02742.1_g00003.1  83 KIASRLP-GRTDNEIKNHWNTH 103
                              8******.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-20568IPR009057Homeodomain-like
PROSITE profilePS5129419.381965IPR017930Myb domain
SMARTSM007176.6E-111363IPR001005SANT/Myb domain
SuperFamilySSF466897.86E-2214105IPR009057Homeodomain-like
PfamPF002495.6E-131461IPR001005SANT/Myb domain
CDDcd001674.99E-81661No hitNo description
SMARTSM007173.866106IPR001005SANT/Myb domain
PROSITE profilePS512949.99666108IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-1083119IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MGRQPCCDKL GVKRGPWTTE EDKKLINFIL TNGHYCWRAL PNLAGLRRCG KSCRLRWTNY  60
LRPDLKRGLL SHDEEQLVIG GPKIASRLPG RTDNEIKNHW NTHIKKKLVK MGIDPVTHQP  120
LNQEPNNTDD NSMEPKSSST KNVETNGITK ENESSSTVTG QNSSMDSESH LLSNIYNDEQ  180
LFSYLWSDES TKAETAWSDG NYDIGGTLYH DSNISGGGAD FPIWSPQINK GKNWTFQDSC  240
QDFGVHDFGF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-19141087108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL0216352e-46AL021635.1 Arabidopsis thaliana DNA chromosome 4, BAC clone T12H17 (ESSAII project).
GenBankAL1615572e-46AL161557.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 57.
GenBankCP0026872e-46CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013627209.11e-149PREDICTED: protein ODORANT1-like isoform X1
RefseqXP_013701026.11e-149PREDICTED: protein ODORANT1-like
SwissprotQ50EX66e-76ODO1_PETHY; Protein ODORANT1
TrEMBLA0A0D3BL081e-149A0A0D3BL08_BRAOL; Uncharacterized protein
STRINGBra020837.1-P1e-146(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22680.11e-133myb domain protein 85